DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG4259

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:121/257 - (47%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   932 RIKNPVYVDGDSEFGEYPWHVAILKKDPKESI--YACGGTLIDAQHIISAAHCIKSQNGFDLRVR 994
            :|:...|  |.:....:||.|::|  |.::.:  |...|:||:...:::|||.:.....:||.||
  Fly    25 QIRRETY--GSNPRATFPWVVSVL--DQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVR 85

  Fly   995 LGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYS 1059
            .||||.:...: ..:::.:|:::..|.::.....:|::|:|.|....:.|.|.::.|..|.:  :
  Fly    86 AGEWDTSTTAD-QQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQE--A 147

  Fly  1060 DFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGE 1124
            ......|:..|||| .:.....|..:||.|.|.:||...|.|:          ||....:|..|.
  Fly   148 GIQKGSCFFNGWGK-VYLNSTDYPTVLKTVQVDLLSMGMCSSR----------KLPIQQICGKGL 201

  Fly  1125 EGKDACKGDGGGPLVCDRNGAMHV---------VGVVSWGIGCGQVNVPGVYVKVSAYLPWI 1177
            ||.| |.||||.||||      .:         ||:|:|.......|...|:..|:..||||
  Fly   202 EGID-CSGDGGAPLVC------RILTYPYKYAQVGIVNWLSQKPVENTFIVFTNVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 71/247 (29%)
Tryp_SPc 942..1177 CDD:214473 69/245 (28%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 71/241 (29%)
Tryp_SPc 39..256 CDD:214473 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.