DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and Prss30

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:277 Identity:93/277 - (33%)
Similarity:141/277 - (50%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   921 CG-VRNAAGITGRIKNPVYVDGDSEFGEYPWHVAI-LKKDPKESIYACGGTLIDAQHIISAAHCI 983
            || .|:|..|.|        ..|:..|::||.|:: :.:|.    :.|||:||....:::||||.
Mouse    65 CGHSRDAGKIVG--------GQDALEGQWPWQVSLWITEDG----HICGGSLIHEVWVLTAAHCF 117

  Fly   984 -KSQNGFDLRVRLGEWDVN----HDVEFFPYIERDVVSVHIHPEY-YAGTLDNDLAVLKLDQPVD 1042
             :|.|.....|::|...::    |....      .|.::.:||.| :|.....|:|:::||.|: 
Mouse   118 RRSLNPSFYHVKVGGLTLSLLEPHSTLV------AVRNIFVHPTYLWADASSGDIALVQLDTPL- 175

  Fly  1043 FTKNPHISPACLPDKYSDFT-GARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCE------ 1100
              :....:|.|||...:..| |..||.||||..   :.....::|:|:.||:|..:.||      
Mouse   176 --RPSQFTPVCLPAAQTPLTPGTVCWVTGWGAT---QERDMASVLQELAVPLLDSEDCEKMYHTQ 235

  Fly  1101 -SQLRNTRLGYSYKLNPGFVCAGGEEG-KDACKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQVNV 1163
             |.|...|:     :....:|||..|| ||:|:||.||||||..|.:...||:.||||||.:...
Mouse   236 GSSLSGERI-----IQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYR 295

  Fly  1164 PGVYVKVSAYLPWIQQI 1180
            ||||.:|..|:.|||:|
Mouse   296 PGVYTRVPTYVDWIQRI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 86/253 (34%)
Tryp_SPc 942..1177 CDD:214473 83/250 (33%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 88/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.