DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and Prss42

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:243 Identity:90/243 - (37%)
Similarity:140/243 - (57%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   942 DSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVNHDVEF 1006
            |:|.|::||.|::..:    .::.|||:|:::|.:::|||||.|:..::  |::|:..|      
  Rat    89 DAEEGKWPWQVSLRVR----HMHVCGGSLLNSQWVLTAAHCIHSRVQYN--VKMGDRSV------ 141

  Fly  1007 FPYIER-----DVVSVHIHPEYYAGT-LDNDLAVLKLDQPVDFTKNPHISPACLP-DKYSDFTGA 1064
              |.:.     .:.::.:||::...| :.||:|:|||.|||:||.:.|  |.|:| ..:....|.
  Rat   142 --YRQNTSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIH--PICVPTGTFHVKAGT 202

  Fly  1065 RCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDA 1129
            :||.|||||...|.......||:|||..|:.:::|...|:.........:..|.|||..|.||||
  Rat   203 KCWVTGWGKPDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCAYKEGGKDA 267

  Fly  1130 CKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWI 1177
            |:||.||||.|:.:.....:||||||||||:...||||..|:.|..|:
  Rat   268 CQGDSGGPLSCEFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 90/243 (37%)
Tryp_SPc 942..1177 CDD:214473 89/241 (37%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 89/240 (37%)
Tryp_SPc 84..315 CDD:238113 89/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 1 0.900 - - OOG6_116535
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.