DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and CG30375

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:303 Identity:84/303 - (27%)
Similarity:145/303 - (47%) Gaps:44/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   887 AYYGNRP-VEKTCRINEVCCRRPLRPQAPPQQFGRCGVRNAAGITGRIKNPVYVDGDSEFG--EY 948
            |||.:.| .::..|:|   |:...|| ||..    ||    .....||.|.|      |.|  |:
  Fly   117 AYYSSSPQTQQRSRLN---CQAVARP-APCD----CG----WSFPNRIANGV------EAGKHEF 163

  Fly   949 PWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQN-GFDLRVRLGEWDVNHDVEFFPYIER 1012
            |..|.:........|: |||:::..::|::||||...|. ...|...:||.|::...|.....:.
  Fly   164 PSMVGLRDLSSNLPIF-CGGSIVSERYIMTAAHCTARQPVASRLLALVGEHDLSTGAESIYAAQY 227

  Fly  1013 DVVSVHIHPEYY---AGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSD--FTGARCWTTGWG 1072
            .:.::..||.|.   :|.: ||:|:|:...|:::::.  ::|.|||.:.::  |........|||
  Fly   228 RIQNIINHPGYMETASGNI-NDIALLQTATPIEWSRG--VAPICLPIRQAENSFNYQNVDIMGWG 289

  Fly  1073 KDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVC---AGGEEGKDACKGDG 1134
              ..|......|.|::..:..:.:..|.|:       ::..:.|..:|   ||| .|:|:|:.|.
  Fly   290 --TLGFAASKSNTLQKATLLTMDNAVCRSR-------FNSSITPSHLCTYDAGG-RGQDSCQYDS 344

  Fly  1135 GGPLVCDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWI 1177
            |||::..:...|..:||:|:|..|||....||..:|:::|.|:
  Fly   345 GGPVILRQRERMFQLGVISYGRACGQPFGIGVNTRVTSHLNWL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 67/247 (27%)
Tryp_SPc 942..1177 CDD:214473 66/245 (27%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 70/254 (28%)
Tryp_SPc 152..387 CDD:238113 69/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.