DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4998 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:256 Identity:93/256 - (36%)
Similarity:135/256 - (52%) Gaps:28/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   937 VYVDGDSEFGE--YPWHVAILKKDPKESIYACGGTLIDAQHIISAAHC----IKSQNGFDLRVRL 995
            |.:.|..|..|  :||.|: |:......|:.|||:||..|.:::||||    |||...|.:::| 
Mouse    30 VGIVGGHEASESKWPWQVS-LRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLR- 92

  Fly   996 GEWDVNHDVEFFPYIERDVVSVH---IHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDK 1057
                     |.:.|....::|::   :||.||......|:|:|:|:.||:.  :.|:.|..||..
Mouse    93 ---------EQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNV--STHLHPISLPPA 146

  Fly  1058 YSDF-TGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRL--GYSYKL-NPGF 1118
            ...| .|..||.||||.....|.......||:|.|||:.:..|:.:. :|.|  |..:.: :.|.
Mouse   147 SETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKY-HTGLYTGDDFPIVHDGM 210

  Fly  1119 VCAGGEEGKDACKGDGGGPLVCDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQ 1179
            :|||... :|:|:||.||||||...|.....||||||.||.|.|.||:|.:|:.||.||.:
Mouse   211 LCAGNTR-RDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 91/251 (36%)
Tryp_SPc 942..1177 CDD:214473 89/247 (36%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 92/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.