powered by:
Protein Alignment CG33060 and Dpy30
DIOPT Version :9
Sequence 1: | NP_788513.2 |
Gene: | CG33060 / 39807 |
FlyBaseID: | FBgn0053060 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001139694.1 |
Gene: | Dpy30 / 66310 |
MGIID: | 1913560 |
Length: | 99 |
Species: | Mus musculus |
Alignment Length: | 60 |
Identity: | 21/60 - (35%) |
Similarity: | 36/60 - (60%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 SEEFQAKECPRTKSFKPPEERRIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDDK 109
:|:..|::..:.|........|.:|:|.|||||::|:..||:|.|.:||.:|..:.|.:|
Mouse 33 NEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNK 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003774 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23356 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.