DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and dpy30

DIOPT Version :9

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001011017.1 Gene:dpy30 / 496426 XenbaseID:XB-GENE-970590 Length:99 Species:Xenopus tropicalis


Alignment Length:39 Identity:19/39 - (48%)
Similarity:28/39 - (71%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDDK 109
            |.:|:|.|||||::|:..||:|.|.:||.||..:.|.:|
 Frog    54 RAYLDQTVVPILLQGLSVLAKERPPNPIEYLAAYLLKNK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 Dpy-30 71..110 CDD:253069 19/39 (49%)
dpy30NP_001011017.1 Dpy-30 52..92 CDD:310056 18/37 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1596051at2759
OrthoFinder 1 1.000 - - FOG0003774
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.