powered by:
Protein Alignment CG33060 and dpy30
DIOPT Version :9
Sequence 1: | NP_788513.2 |
Gene: | CG33060 / 39807 |
FlyBaseID: | FBgn0053060 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001011017.1 |
Gene: | dpy30 / 496426 |
XenbaseID: | XB-GENE-970590 |
Length: | 99 |
Species: | Xenopus tropicalis |
Alignment Length: | 39 |
Identity: | 19/39 - (48%) |
Similarity: | 28/39 - (71%) |
Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 RIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDDK 109
|.:|:|.|||||::|:..||:|.|.:||.||..:.|.:|
Frog 54 RAYLDQTVVPILLQGLSVLAKERPPNPIEYLAAYLLKNK 92
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1596051at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003774 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.