DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and Dpy-30L1

DIOPT Version :9

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_609445.1 Gene:Dpy-30L1 / 34480 FlyBaseID:FBgn0032293 Length:134 Species:Drosophila melanogaster


Alignment Length:110 Identity:34/110 - (30%)
Similarity:54/110 - (49%) Gaps:12/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKVNTRKNVKPSPNKTK-KNPSAIISILCPDGDKPNKEAKPKKNGGSEEFQAKECPRTKSFKPPE 68
            |:.|...|.:.:|.... ..||..|::    |...|..|:.::    :...||: |.:::...| 
  Fly    23 KEPNASSNAQANPTAAPGAPPSGAIAV----GQSTNPVAQQQQ----QPAVAKK-PSSETNNMP- 77

  Fly    69 ERRIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDDKHKCD 113
             .|.:|:|.|.|:|:.||..||||.|.|||.:|..:.|...:.||
  Fly    78 -TRQYLDQTVAPVLLHGMQALARERPTDPIQFLASYLLKHSNGCD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 Dpy-30 71..110 CDD:253069 18/38 (47%)
Dpy-30L1NP_609445.1 Dpy-30 77..118 CDD:253069 19/42 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1596051at2759
OrthoFinder 1 1.000 - - FOG0003774
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.