DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and sdc1

DIOPT Version :9

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_588390.1 Gene:sdc1 / 2539145 PomBaseID:SPCC18.11c Length:109 Species:Schizosaccharomyces pombe


Alignment Length:55 Identity:21/55 - (38%)
Similarity:32/55 - (58%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RIFLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLD-------DKHKCDIPLPQ 118
            |.:|.::|.|:|:|||..|||:.|.:|:.:|.:|.||       .|...:.|.||
pombe     8 RQYLNEKVTPVLLEGMKILARDRPENPLQFLGQFLLDANANQQKQKEIVNQPEPQ 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 Dpy-30 71..110 CDD:253069 17/45 (38%)
sdc1NP_588390.1 Dpy-30 6..47 CDD:253069 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003774
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.