powered by:
Protein Alignment CG33060 and tric-1B.2
DIOPT Version :9
Sequence 1: | NP_788513.2 |
Gene: | CG33060 / 39807 |
FlyBaseID: | FBgn0053060 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_496606.2 |
Gene: | tric-1B.2 / 190342 |
WormBaseID: | WBGene00013268 |
Length: | 313 |
Species: | Caenorhabditis elegans |
Alignment Length: | 32 |
Identity: | 10/32 - (31%) |
Similarity: | 15/32 - (46%) |
Gaps: | 2/32 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 GGSEEFQAKECPRTKSFKPPEERRIFLEQEVV 79
||..:..||....|| |.....|:..|:|::
Worm 258 GGIIDAFAKAVDATK--KAIHSNRVLSEEEIL 287
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33060 | NP_788513.2 |
Dpy-30 |
71..110 |
CDD:253069 |
3/9 (33%) |
tric-1B.2 | NP_496606.2 |
TRIC |
51..235 |
CDD:310067 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3944 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.