DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and tric-1B.2

DIOPT Version :9

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_496606.2 Gene:tric-1B.2 / 190342 WormBaseID:WBGene00013268 Length:313 Species:Caenorhabditis elegans


Alignment Length:32 Identity:10/32 - (31%)
Similarity:15/32 - (46%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GGSEEFQAKECPRTKSFKPPEERRIFLEQEVV 79
            ||..:..||....||  |.....|:..|:|::
 Worm   258 GGIIDAFAKAVDATK--KAIHSNRVLSEEEIL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 Dpy-30 71..110 CDD:253069 3/9 (33%)
tric-1B.2NP_496606.2 TRIC 51..235 CDD:310067
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3944
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.