DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and R05G6.5

DIOPT Version :10

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_501212.1 Gene:R05G6.5 / 187622 WormBaseID:WBGene00019899 Length:188 Species:Caenorhabditis elegans


Alignment Length:36 Identity:14/36 - (38%)
Similarity:19/36 - (52%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FLEQEVVPILMEGMLGLAREMPRDPIGYLQKFWLDD 108
            :|..||.|.|.:|:..:|.|.|.:||.     ||.|
 Worm   151 YLSVEVWPKLSQGLARVAVERPDNPIK-----WLAD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 DD_R_PKA_DPY30-like 71..111 CDD:445844 14/36 (39%)
R05G6.5NP_501212.1 Dpy-30 147..188 CDD:428357 14/36 (39%)

Return to query results.
Submit another query.