DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and dpy-30

DIOPT Version :10

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_506058.1 Gene:dpy-30 / 179671 WormBaseID:WBGene00001088 Length:123 Species:Caenorhabditis elegans


Alignment Length:100 Identity:29/100 - (28%)
Similarity:49/100 - (49%) Gaps:23/100 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSPNKTKKN---PSAIISILCPDGDKPNKEAKPKKNGGSEEFQAKECPRTKSFKPPEERRIFLEQ 76
            |:..::.:|   ||.::|                .||| ::...:..||..|..|   .|.:|:.
 Worm    32 PAEAESNENTTVPSNVLS----------------ANGG-QQTGNQSAPRNTSTVP---TRQYLDS 76

  Fly    77 EVVPILMEGMLGLAREMPRDPIGYLQKFWLDDKHK 111
            .|||||::|:..||::.|.:||.:|..|.|.:|.:
 Worm    77 TVVPILLQGLGALAKDRPENPIEFLANFLLREKDR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 DD_R_PKA_DPY30-like 71..111 CDD:445844 17/39 (44%)
dpy-30NP_506058.1 DD_DPY30_SDC1 70..110 CDD:438534 16/39 (41%)

Return to query results.
Submit another query.