DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13040 and CG34267

DIOPT Version :9

Sequence 1:NP_001261936.1 Gene:CG13040 / 39804 FlyBaseID:FBgn0036608 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001097464.1 Gene:CG34267 / 5740365 FlyBaseID:FBgn0085296 Length:77 Species:Drosophila melanogaster


Alignment Length:128 Identity:46/128 - (35%)
Similarity:55/128 - (42%) Gaps:56/128 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRFIA-ICALATIVAAAPGFIEEHPVAVAPVVAKVGAVVHSAPLATSHQSFTQYHNQAVLTPVV 64
            |||.|| |.||..:..||||:||. ...|.| ||:|                             
  Fly     1 MFRIIAVIFALVAMAFAAPGYIEP-SYGVVP-VAQV----------------------------- 34

  Fly    65 KHVVPAVPVIKTVAPVVPVVKHVAPIVPVVKQVAPIVPVVKHVAPVVPVIKT--VPVVHHQTY 125
                  |||:|:    ||||:|    |||||.    ||||:|    |||:|:  ||...|..|
  Fly    35 ------VPVVKS----VPVVQH----VPVVKN----VPVVQH----VPVLKSYAVPTYGHHIY 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13040NP_001261936.1 Retinin_C <40..94 CDD:282395 11/53 (21%)
CG34267NP_001097464.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.