DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13040 and CG13059

DIOPT Version :9

Sequence 1:NP_001261936.1 Gene:CG13040 / 39804 FlyBaseID:FBgn0036608 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_648874.2 Gene:CG13059 / 39803 FlyBaseID:FBgn0036607 Length:155 Species:Drosophila melanogaster


Alignment Length:161 Identity:64/161 - (39%)
Similarity:81/161 - (50%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRFIAICALATIVAAAPGFI-EEHPVAVAPVVAKVGAVVHSAPLATSHQSFTQ----------- 53
            ||:|:|..|...:.|||||.| |.|.:....::||...|..||..|.:|||...           
  Fly     1 MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQSNVNLVRKVPVVYSA 65

  Fly    54 --YHNQAVL--TPVVKHVVPAVPVIKTVAPVVPVVKHVAPIVPVVKQVAPIVPVVKHVAPVVPVI 114
              .|...|:  .|:||.|:||.|::|||.|..||:|.|....|:|..|.|..|:||.|.|..|||
  Fly    66 PVVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVLKTVVSSAPLVHTVVPAAPLVKTVIPAAPVI 130

  Fly   115 KTV-PVVHHQTYVAPAVHHVAAVPVVKALPH 144
            ||| |       .||.||.|.:.|||.:..|
  Fly   131 KTVIP-------AAPLVHTVHSAPVVYSAYH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13040NP_001261936.1 Retinin_C <40..94 CDD:282395 24/68 (35%)
CG13059NP_648874.2 rne <22..152 CDD:236766 52/136 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.