powered by:
Protein Alignment CG13040 and CG4982
DIOPT Version :9
Sequence 1: | NP_001261936.1 |
Gene: | CG13040 / 39804 |
FlyBaseID: | FBgn0036608 |
Length: | 185 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648866.1 |
Gene: | CG4982 / 39794 |
FlyBaseID: | FBgn0036598 |
Length: | 113 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 22/61 - (36%) |
Similarity: | 31/61 - (50%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 128 PAVHHVAAVPVV-----KALPHAVSHQSHTQVHHQKTIITPVV--APVVKTVAVAAAPVAH 181
|:..||...|.| .|||.||||||.|.||.::....|:| .|::|.....|..:::
Fly 24 PSYEHVEYAPSVVGYESYALPAAVSHQSSTVVHEKRPYWRPIVDHTPILKAAYAPATSISY 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13040 | NP_001261936.1 |
Retinin_C |
<40..94 |
CDD:282395 |
|
CG4982 | NP_648866.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34931 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.