DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13040 and CG4982

DIOPT Version :10

Sequence 1:NP_648875.1 Gene:CG13040 / 39804 FlyBaseID:FBgn0036608 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_648866.1 Gene:CG4982 / 39794 FlyBaseID:FBgn0036598 Length:113 Species:Drosophila melanogaster


Alignment Length:61 Identity:22/61 - (36%)
Similarity:31/61 - (50%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PAVHHVAAVPVV-----KALPHAVSHQSHTQVHHQKTIITPVV--APVVKTVAVAAAPVAH 181
            |:..||...|.|     .|||.||||||.|.||.::....|:|  .|::|.....|..:::
  Fly    24 PSYEHVEYAPSVVGYESYALPAAVSHQSSTVVHEKRPYWRPIVDHTPILKAAYAPATSISY 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13040NP_648875.1 PHA02030 <66..120 CDD:222843
CG4982NP_648866.1 Retinin_C 36..82 CDD:427994 17/45 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.