DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13059 and CG13041

DIOPT Version :9

Sequence 1:NP_648874.2 Gene:CG13059 / 39803 FlyBaseID:FBgn0036607 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster


Alignment Length:167 Identity:69/167 - (41%)
Similarity:82/167 - (49%) Gaps:56/167 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQSNVNLVRKV---PVV 62
            ||||||..| |.||.|:.||| |||.:|...:|||...|..||.||::|||...:..|.   |||
  Fly     1 MFKFVAVIA-LLVATASAGLI-ETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVV 63

  Fly    63 --------YSAP--VVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVLKTVVSSAPLVHTVVPAA 117
                    ||.|  .||||||||:.|              |:.|||    ||.|.||||    :|
  Fly    64 APIVKTTTYSHPAVAVHAAPVVHSVP--------------VVHAAP----VVHSVPLVH----SA 106

  Fly   118 PLVKTVIPAAPVIKTVIPAAPLVHTVHSAPVVYSAYH 154
            ||||:|                   |||||:.|:.:|
  Fly   107 PLVKSV-------------------VHSAPLAYTLHH 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13059NP_648874.2 rne <22..152 CDD:236766 54/142 (38%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26655
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.