DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13059 and CG13042

DIOPT Version :9

Sequence 1:NP_648874.2 Gene:CG13059 / 39803 FlyBaseID:FBgn0036607 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster


Alignment Length:116 Identity:48/116 - (41%)
Similarity:64/116 - (55%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVAFFACLAVAAAAPGLIAE---THSIVQPAI-----LAKTAYVDTSASSAITHQSNVNLVR 57
            |:|.|.|||.|||.||.||.:..   .||...|||     |||...:..:..||::||| ::.|.
  Fly     1 MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQS-ISQVH 64

  Fly    58 KVPVVYSAPVVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVLKTVVSSAP 108
            .     ||.::.  |:|  ||:|||.  |||::||.  |||.|.|.:.|:|
  Fly    65 S-----SAHIIQ--PIV--APVVKTY--AAPIIKTY--AAPALHTTLLSSP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13059NP_648874.2 rne <22..152 CDD:236766 35/95 (37%)
CG13042NP_648870.1 Retinin_C 35..93 CDD:309599 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.