DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13060 and retinin

DIOPT Version :9

Sequence 1:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_524995.2 Gene:retinin / 53564 FlyBaseID:FBgn0040074 Length:191 Species:Drosophila melanogaster


Alignment Length:97 Identity:38/97 - (39%)
Similarity:50/97 - (51%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHS-KAVVQPVVAPIVKTTTYSH 74
            |:..|..|| .|...:.||.:||||.||...|:|||||:.|.||. :.:|.|:|||.|:||    
  Fly   108 LILAARNGL-RTVLTIQEPAVAKVGEVVQHVPTAVSHQTQTVVHDHRRLVTPIVAPAVRTT---- 167

  Fly    75 PAVAVHAAPVVHSVPVVHAAPVVHSVHSAPVV 106
                    .|:...|     |::.||.|.|.|
  Fly   168 --------QVIRQQP-----PLLWSVASDPRV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 25/48 (52%)
retininNP_524995.2 Retinin_C 122..>169 CDD:309599 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.