DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13060 and CG13059

DIOPT Version :9

Sequence 1:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648874.2 Gene:CG13059 / 39803 FlyBaseID:FBgn0036607 Length:155 Species:Drosophila melanogaster


Alignment Length:167 Identity:68/167 - (40%)
Similarity:87/167 - (52%) Gaps:49/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFIGVIA-LLVATASAGLI-ETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVV 63
            ||||:...| |.||.|:.||| |||.:|...:|||...|..||.||::|||...:..|.   |||
  Fly     1 MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQSNVNLVRKV---PVV 62

  Fly    64 APIVKTTTYSHPAVAVHAAPVVHSVP--------------VVHAAPVVHS-VHSAPVVHSVLHSA 113
                    ||.|  .||||||||:.|              |:.||||:.: |.|||:||:|:.:|
  Fly    63 --------YSAP--VVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVLKTVVSSAPLVHTVVPAA 117

  Fly   114 PLVKSV-------------------VHSAPLAYTLHH 131
            ||||:|                   |||||:.|:.:|
  Fly   118 PLVKTVIPAAPVIKTVIPAAPLVHTVHSAPVVYSAYH 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 16/47 (34%)
CG13059NP_648874.2 rne <22..152 CDD:236766 55/142 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26655
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.