DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13060 and CG13041

DIOPT Version :9

Sequence 1:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster


Alignment Length:131 Identity:121/131 - (92%)
Similarity:123/131 - (93%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFIGVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65
            ||||:.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65

  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVHSAPVVHSVLHSAPLVKSVVHSAPLAYTLH 130
            |||||||||||||||||||||||||||||||||||   |:|    ||||||||||||||||||||
  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV---PLV----HSAPLVKSVVHSAPLAYTLH 123

  Fly   131 H 131
            |
  Fly   124 H 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 47/47 (100%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 47/47 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449076
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26655
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.