DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13060 and CG13063

DIOPT Version :9

Sequence 1:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster


Alignment Length:140 Identity:63/140 - (45%)
Similarity:83/140 - (59%) Gaps:28/140 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFIGVIALL-VATASAG-LIET---------HHVVHEPVLAKVGSVVHSAPSAVSHQSITQVH 54
            |||.:.:.||| ||.|..| |.|:         ..||.|..||||||||.|.|::|||||.:.||
  Fly     1 MFKLVVLSALLAVAVARPGHLYESPLVYAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSVVH 65

  Fly    55 SKA-VVQPVVAPIVKTTTYSHPAVA-VHAAPVVHSVPVVHAAPVVHSVHSAPVVHSVLHSAPLVK 117
            |.: ||:.:|||:||:|    |.|: ..||||||:  ...||||||:.::|||||:         
  Fly    66 SHSHVVEDIVAPVVKST----PVVSYAAAAPVVHT--AYAAAPVVHTSYAAPVVHT--------- 115

  Fly   118 SVVHSAPLAY 127
            |...::|:.|
  Fly   116 SYAAASPVVY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 29/48 (60%)
CG13063NP_648869.1 rne <11..124 CDD:236766 57/127 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.