DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13041 and CG13044

DIOPT Version :9

Sequence 1:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster


Alignment Length:152 Identity:73/152 - (48%)
Similarity:89/152 - (58%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVAVIALL-VATASAGLI----------ETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVH 54
            |||...:.||| ||.|..|.:          .|..||.||||||||:||.|.|:||||||:||||
  Fly     1 MFKLFVLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQVH 65

  Fly    55 SKAVVQPVVAPIVKTTTYSHPAVAVHAAPVVHSVPVVHA-APVVHSVPLVHSAPLVKS------- 111
            |..||:.||||:||||       |||:|||:.:.|:|.. |||.:|.||.:|||:..|       
  Fly    66 STPVVEDVVAPVVKTT-------AVHSAPVLAAAPIVKTLAPVAYSAPLAYSAPVAYSSYAAPLT 123

  Fly   112 ----VVHSAPLAYT-----LHH 124
                |.:||||:|.     |||
  Fly   124 YSAPVAYSAPLSYAAPAPLLHH 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 35/47 (74%)
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 41/63 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.