DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13041 and CG4982

DIOPT Version :10

Sequence 1:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_648866.1 Gene:CG4982 / 39794 FlyBaseID:FBgn0036598 Length:113 Species:Drosophila melanogaster


Alignment Length:91 Identity:34/91 - (37%)
Similarity:49/91 - (53%) Gaps:11/91 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFV----AVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVV-Q 60
            |||.|    .|.|:|:....:.|....||.:.|  :.||...::.|:||||||.|.||.|... :
  Fly     1 MFKVVFLLCGVFAVLIQARPSYLPSYEHVEYAP--SVVGYESYALPAAVSHQSSTVVHEKRPYWR 63

  Fly    61 PVV--APIVKTTTYSHPAVAVHAAPV 84
            |:|  .||:| ..|: ||.::..||:
  Fly    64 PIVDHTPILK-AAYA-PATSISYAPL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13041NP_648872.1 Retinin_C 25..>73 CDD:427994 20/50 (40%)
CG4982NP_648866.1 Retinin_C 36..82 CDD:427994 21/47 (45%)

Return to query results.
Submit another query.