DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13041 and CG4962

DIOPT Version :9

Sequence 1:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_648865.1 Gene:CG4962 / 39793 FlyBaseID:FBgn0036597 Length:123 Species:Drosophila melanogaster


Alignment Length:106 Identity:37/106 - (34%)
Similarity:57/106 - (53%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65
            |||.:|:|:.|.|.|:||:|..:...:........:..::||:.:||..|.    |:...|:||.
  Fly     1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPII----KSYAAPIVAH 61

  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVPLVHSA 106
            .|.|:..:...||..|.||||:.|:|||.|.:||....|.:
  Fly    62 PVATSYANTYKVATKAIPVVHAAPLVHAVPALHSTSTYHGS 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 11/47 (23%)
CG4962NP_648865.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.