DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13062 and CG13042

DIOPT Version :9

Sequence 1:NP_648871.3 Gene:CG13062 / 39799 FlyBaseID:FBgn0036603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster


Alignment Length:102 Identity:42/102 - (41%)
Similarity:56/102 - (54%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLVVSLLSICALTAARPGFLHG----HHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVH 61
            |.|||| ..::.|:.|||||:|..    |.:..|.|.:.|....|..:...:|:||||||.:.||
  Fly     1 MYKLVV-FFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQSISQVH 64

  Fly    62 SVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAY 98
            | ..|||:|::.| ||||          :.|||||.|
  Fly    65 S-SAHIIQPIVAP-VVKT----------YAAPIIKTY 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13062NP_648871.3 Retinin_C 32..95 CDD:282395 24/62 (39%)
CG13042NP_648870.1 Retinin_C 35..93 CDD:309599 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.