DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13042 and CG13040

DIOPT Version :9

Sequence 1:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001261936.1 Gene:CG13040 / 39804 FlyBaseID:FBgn0036608 Length:185 Species:Drosophila melanogaster


Alignment Length:141 Identity:41/141 - (29%)
Similarity:61/141 - (43%) Gaps:56/141 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQSISQVHS 65
            |::.:...||..:|||.||::|..|         :...|.:|||||::.:.|.|.||||.:|.|:
  Fly     1 MFRFIAICALATIVAAAPGFIEEHP---------VAVAPVVAKVGAVVHSAPLATSHQSFTQYHN 56

  Fly    66 SAHIIQPIV------APVVKTYA-------------------APII------------------- 86
            .| ::.|:|      .||:||.|                   |||:                   
  Fly    57 QA-VLTPVVKHVVPAVPVIKTVAPVVPVVKHVAPIVPVVKQVAPIVPVVKHVAPVVPVIKTVPVV 120

  Fly    87 --KTYAAPALH 95
              :||.|||:|
  Fly   121 HHQTYVAPAVH 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13042NP_648870.1 Retinin_C 35..93 CDD:309599 28/103 (27%)
CG13040NP_001261936.1 Retinin_C <40..94 CDD:282395 16/54 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.