DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13042 and CG13041

DIOPT Version :9

Sequence 1:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster


Alignment Length:98 Identity:47/98 - (47%)
Similarity:66/98 - (67%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQSISQVHS 65
            |:|.|...||| |..|..|.:|:    |.     ::|||.|||||:::.:.|||||||||:||||
  Fly     1 MFKFVAVIALL-VATASAGLIET----HH-----VVHEPVLAKVGSVVHSAPSAVSHQSITQVHS 55

  Fly    66 SAHIIQPIVAPVVK--TYAAPIIKTYAAPALHT 96
            .| ::||:|||:||  ||:.|.:..:|||.:|:
  Fly    56 KA-VVQPVVAPIVKTTTYSHPAVAVHAAPVVHS 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13042NP_648870.1 Retinin_C 35..93 CDD:309599 34/59 (58%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 30/48 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 1 0.900 - - E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.