DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13042 and CG13062

DIOPT Version :10

Sequence 1:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648871.3 Gene:CG13062 / 39799 FlyBaseID:FBgn0036603 Length:118 Species:Drosophila melanogaster


Alignment Length:102 Identity:42/102 - (41%)
Similarity:56/102 - (54%) Gaps:17/102 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVV-FFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQSISQVH 64
            |.|||| ..::.|:.|||||:|..    |.:..|.|.:.|....|..:...:|:||||||.:.||
  Fly     1 MMKLVVSLLSICALTAARPGFLHG----HHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVH 61

  Fly    65 S-SAHIIQPIVAP-VVKT----------YAAPIIKTY 89
            | ..|||:|::.| ||||          :.|||||.|
  Fly    62 SVPHHIIKPVLLPTVVKTVVHPPIIKAYHPAPIIKAY 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13042NP_648870.1 Retinin_C 35..93 CDD:427994 28/67 (42%)
CG13062NP_648871.3 Retinin_C 40..95 CDD:427994 22/54 (41%)

Return to query results.
Submit another query.