DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13042 and CG13063

DIOPT Version :9

Sequence 1:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster


Alignment Length:131 Identity:58/131 - (44%)
Similarity:82/131 - (62%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPA---IIHEPALAKVGAIIKTVPSAVSHQSISQ 62
            |:||||..|||||..||||:|...||:  |||||   ::.|.:|||||:::.::|::|||||.|.
  Fly     1 MFKLVVLSALLAVAVARPGHLYESPLV--YAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSV 63

  Fly    63 VHSSAHIIQPIVAPVVKT-----------------YAAPIIKT-YAAPALHTT-------LLSSP 102
            |||.:|:::.|||||||:                 .|||::.| ||||.:||:       :.:|.
  Fly    64 VHSHSHVVEDIVAPVVKSTPVVSYAAAAPVVHTAYAAAPVVHTSYAAPVVHTSYAAASPVVYNSS 128

  Fly   103 W 103
            |
  Fly   129 W 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13042NP_648870.1 Retinin_C 35..93 CDD:309599 31/75 (41%)
CG13063NP_648869.1 rne <11..124 CDD:236766 49/114 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470230
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.