powered by:
Protein Alignment CG13063 and retinin
DIOPT Version :9
Sequence 1: | NP_648869.1 |
Gene: | CG13063 / 39797 |
FlyBaseID: | FBgn0036601 |
Length: | 129 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524995.2 |
Gene: | retinin / 53564 |
FlyBaseID: | FBgn0040074 |
Length: | 191 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 31/64 - (48%) |
Similarity: | 43/64 - (67%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PLVYAAP---AATTVVQERSLAKVGSVVSSIPTSVSHQSQSVVHSHSHVVEDIVAPVVKSTPVV 85
||:.||. .....:||.::||||.||..:||:||||:|:|||.|..:|..||||.|::|.|:
Fly 107 PLILAARNGLRTVLTIQEPAVAKVGEVVQHVPTAVSHQTQTVVHDHRRLVTPIVAPAVRTTQVI 170
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13063 | NP_648869.1 |
rne |
<11..124 |
CDD:236766 |
31/64 (48%) |
retinin | NP_524995.2 |
Retinin_C |
122..>169 |
CDD:309599 |
26/46 (57%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45470233 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34931 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.