DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13063 and CG13043

DIOPT Version :10

Sequence 1:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_648868.2 Gene:CG13043 / 39796 FlyBaseID:FBgn0036600 Length:148 Species:Drosophila melanogaster


Alignment Length:130 Identity:111/130 - (85%)
Similarity:120/130 - (92%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLVVLSALLAVAVARPGHLYE-SPLVYAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSVV 64
            ||||||||||||||.||||||.| ||||||||||||:|||..|||||:||.|:||:|||||||||
  Fly     1 MFKLVVLSALLAVAAARPGHLLESSPLVYAAPAATTIVQEPVLAKVGAVVKSVPTAVSHQSQSVV 65

  Fly    65 HSHSHVVEDIVAPVVKSTPVVSYAAAAPVVHTAYAAAPVVHTSYA--APVVHTSYAAASPVVYNS 127
            |||:|||||:||||||||||||||||||||||:||||||||||||  |||||||||||:||:..|
  Fly    66 HSHAHVVEDVVAPVVKSTPVVSYAAAAPVVHTSYAAAPVVHTSYAAPAPVVHTSYAAAAPVLATS 130

  Fly   128  127
              Fly   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13063NP_648869.1 rne <11..124 CDD:236766 99/115 (86%)
CG13043NP_648868.2 Retinin_C 37..105 CDD:427994 57/67 (85%)

Return to query results.
Submit another query.