DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13063 and CG13044

DIOPT Version :9

Sequence 1:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster


Alignment Length:156 Identity:85/156 - (54%)
Similarity:109/156 - (69%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLVVLSALLAVAVARPGHLYESPLVYAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSVVH 65
            ||||.||:||||||.|:||||..:||||:|||.||||||..|||||:||.|:||:|||||.:.||
  Fly     1 MFKLFVLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQVH 65

  Fly    66 SHSHVVEDIVAPVVKSTPVVS--YAAAAPVVHT----AYAA-----APVVHTSYAAPVVHT---- 115
            | :.||||:||||||:|.|.|  ..||||:|.|    ||:|     |||.::|||||:.::    
  Fly    66 S-TPVVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAYSAPLAYSAPVAYSSYAAPLTYSAPVA 129

  Fly   116 -----SYAAASPVVYNS-------SW 129
                 ||||.:|:::::       ||
  Fly   130 YSAPLSYAAPAPLLHHAPLTYAAGSW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13063NP_648869.1 rne <11..124 CDD:236766 75/132 (57%)
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470228
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 1 0.900 - - E1_2D4X2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I7193
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016591
OrthoInspector 1 1.000 - - mtm9680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.