DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13063 and CG4982

DIOPT Version :9

Sequence 1:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_648866.1 Gene:CG4982 / 39794 FlyBaseID:FBgn0036598 Length:113 Species:Drosophila melanogaster


Alignment Length:101 Identity:35/101 - (34%)
Similarity:49/101 - (48%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLV-VLSALLAVAV-ARPGHLYESPLVYAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSV 63
            |||:| :|..:.||.: |||.:|.....|..||:.           ||....::|.:|||||.:|
  Fly     1 MFKVVFLLCGVFAVLIQARPSYLPSYEHVEYAPSV-----------VGYESYALPAAVSHQSSTV 54

  Fly    64 VHSHSHVVEDIVAPVVKSTPVVSYAAAAPVVHTAYA 99
            ||..    .....|:|..||::. ||.||....:||
  Fly    55 VHEK----RPYWRPIVDHTPILK-AAYAPATSISYA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13063NP_648869.1 rne <11..124 CDD:236766 30/90 (33%)
CG4982NP_648866.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.