DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13043 and CG13063

DIOPT Version :9

Sequence 1:NP_648868.2 Gene:CG13043 / 39796 FlyBaseID:FBgn0036600 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_648869.1 Gene:CG13063 / 39797 FlyBaseID:FBgn0036601 Length:129 Species:Drosophila melanogaster


Alignment Length:130 Identity:111/130 - (85%)
Similarity:120/130 - (92%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLVVLSALLAVAAARPGHLLESSPLVYAAPAATTIVQEPVLAKVGAVVKSVPTAVSHQSQSVV 65
            ||||||||||||||.||||||.| ||||||||||||:|||..|||||:||.|:||:|||||||||
  Fly     1 MFKLVVLSALLAVAVARPGHLYE-SPLVYAAPAATTVVQERSLAKVGSVVSSIPTSVSHQSQSVV 64

  Fly    66 HSHAHVVEDVVAPVVKSTPVVSYAAAAPVVHTSYAAAPVVHTSYAAPAPVVHTSYAAAAPVLATS 130
            |||:|||||:||||||||||||||||||||||:||||||||||||  |||||||||||:||:..|
  Fly    65 HSHSHVVEDIVAPVVKSTPVVSYAAAAPVVHTAYAAAPVVHTSYA--APVVHTSYAAASPVVYNS 127

  Fly   131  130
              Fly   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13043NP_648868.2 Retinin_C 37..105 CDD:282395 57/67 (85%)
CG13063NP_648869.1 rne <11..124 CDD:236766 99/115 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470227
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 1 0.900 - - E1_2D4X2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I7193
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26590
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016591
OrthoInspector 1 1.000 - - mtm9680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.