DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13043 and CG13044

DIOPT Version :9

Sequence 1:NP_648868.2 Gene:CG13043 / 39796 FlyBaseID:FBgn0036600 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster


Alignment Length:166 Identity:101/166 - (60%)
Similarity:118/166 - (71%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLVVLSALLAVAAARPGHLLESSPLVYAAPAATTIVQEPVLAKVGAVVKSVPTAVSHQSQSVV 65
            ||||.||:||||||||:||| |.::||||:|||.||:||||||||||||||||||||||||.:.|
  Fly     1 MFKLFVLAALLAVAAAKPGH-LAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQV 64

  Fly    66 HSHAHVVEDVVAPVVKSTPVVS--YAAAAPVVHT----SYAA-----APVVHTSYAAP----APV 115
            || ..|||||||||||:|.|.|  ..||||:|.|    :|:|     |||.::|||||    |||
  Fly    65 HS-TPVVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAYSAPLAYSAPVAYSSYAAPLTYSAPV 128

  Fly   116 VHT---SYAAAAPVLATSYAQVAASSPLTYTATGVW 148
            .::   ||||.||:|        ..:|||| |.|.|
  Fly   129 AYSAPLSYAAPAPLL--------HHAPLTY-AAGSW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13043NP_648868.2 Retinin_C 37..105 CDD:282395 51/78 (65%)
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 43/57 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470229
Domainoid 1 1.000 69 1.000 Domainoid score I16588
eggNOG 1 0.900 - - E1_2D4X2
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I7193
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016591
OrthoInspector 1 1.000 - - mtm9680
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.