DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG34267

DIOPT Version :10

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001097464.1 Gene:CG34267 / 5740365 FlyBaseID:FBgn0085296 Length:77 Species:Drosophila melanogaster


Alignment Length:84 Identity:34/84 - (40%)
Similarity:46/84 - (54%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLF-VLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQV 64
            ||::. |:.||:|:|.|.||        |..|:...|   || |:|..||||||..   |.:..|
  Fly     1 MFRIIAVIFALVAMAFAAPG--------YIEPSYGVV---PV-AQVVPVVKSVPVV---QHVPVV 50

  Fly    65 HSTPVVEDVVAPVVKTTAV 83
            .:.|||:.|  ||:|:.||
  Fly    51 KNVPVVQHV--PVLKSYAV 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..102 CDD:427994 22/48 (46%)
CG34267NP_001097464.1 None

Return to query results.
Submit another query.