DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG34268

DIOPT Version :10

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster


Alignment Length:104 Identity:39/104 - (37%)
Similarity:52/104 - (50%) Gaps:29/104 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLF-VLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQV 64
            ||::. |:.||:|:|.|.||        |..|:...|   || |:|..|||||| .|.|      
  Fly     1 MFRIIAVIFALVAMAFAAPG--------YIEPSYGVV---PV-AQVVPVVKSVP-VVKH------ 46

  Fly    65 HSTPVVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAY 103
              .|||:.|  ||||     :.||:...|::|:.|...|
  Fly    47 --VPVVQHV--PVVK-----NVPVVQHVPVLKSYAVPTY 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..102 CDD:427994 26/65 (40%)
CG34268NP_001097465.1 None

Return to query results.
Submit another query.