DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG13056

DIOPT Version :10

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster


Alignment Length:80 Identity:31/80 - (38%)
Similarity:43/80 - (53%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLFVLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQVH-S 66
            ::::..|||....|    |..|.|....| ..|:...|..||||.:|:.|||||||||.|.|| |
  Fly     4 RMYLSFALLLCLLA----LGNADLQLYHP-LMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRS 63

  Fly    67 TPVVEDVVAPVVKTT 81
            .|....::.|.:::|
  Fly    64 VPRTTSLLTPALRST 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..102 CDD:427994 22/47 (47%)
CG13056NP_652414.2 Retinin_C 34..83 CDD:427994 22/45 (49%)

Return to query results.
Submit another query.