DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG13040

DIOPT Version :9

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001261936.1 Gene:CG13040 / 39804 FlyBaseID:FBgn0036608 Length:185 Species:Drosophila melanogaster


Alignment Length:158 Identity:61/158 - (38%)
Similarity:81/158 - (51%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLFVLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQVH 65
            ||:...:.||..:.||.||.:...|          |...||:|||||||.|.|.|.||||.||.|
  Fly     1 MFRFIAICALATIVAAAPGFIEEHP----------VAVAPVVAKVGAVVHSAPLATSHQSFTQYH 55

  Fly    66 S----TPVVEDVV--APVVKTTA------VHSAPVLAAAPIVKTLAPVAYSAPLA-YSAPVAYSS 117
            :    ||||:.||  .||:||.|      .|.||::   |:||.:||:   .|:. :.|||    
  Fly    56 NQAVLTPVVKHVVPAVPVIKTVAPVVPVVKHVAPIV---PVVKQVAPI---VPVVKHVAPV---- 110

  Fly   118 YAAPLTYSAPVAYSAPLSYAAPAPLLHH 145
              .|:..:.||.:..  :|.|||  :||
  Fly   111 --VPVIKTVPVVHHQ--TYVAPA--VHH 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 34/68 (50%)
CG13040NP_001261936.1 Retinin_C <40..94 CDD:282395 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.