DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG13042

DIOPT Version :10

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster


Alignment Length:126 Identity:61/126 - (48%)
Similarity:85/126 - (67%) Gaps:24/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLFVLAALLAVAAAKPGHLAAAPLV--YSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQ 63
            |:||.|..|||||.||:||:|.:.||:  |:|||   ::.||.||||||::|:||:||||||::|
  Fly     1 MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPA---IIHEPALAKVGAIIKTVPSAVSHQSISQ 62

  Fly    64 VHSTP-VVEDVVAPVVKTTAVHSAPVLAAAPIVKTLAPVAYSAPLAY----SAPVAYSSYA 119
            |||:. :::.:|||||||         .||||:||     |:||..:    |:|.|...:|
  Fly    63 VHSSAHIIQPIVAPVVKT---------YAAPIIKT-----YAAPALHTTLLSSPWAGHGWA 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..102 CDD:427994 34/66 (52%)
CG13042NP_648870.1 Retinin_C 35..93 CDD:427994 36/71 (51%)

Return to query results.
Submit another query.