DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13044 and CG34205

DIOPT Version :9

Sequence 1:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster


Alignment Length:196 Identity:65/196 - (33%)
Similarity:89/196 - (45%) Gaps:69/196 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLFVLAALLAVAAAKPG---------------------HLAAAPLV--YSAPATTTVVQEPVLAK 44
            ||.:|.:|||||.|.||                     :.||||::  |:|||.|.....||:..
  Fly    24 KLLILTSLLAVATAAPGLLDYGHSAPDYSYAHAAPAITYAAAAPVIKSYAAPAITYAAPAPVIKS 88

  Fly    45 VGA------------------VVKS--VPTAV---------SHQSLTQVHSTPVVEDVVAPVVKT 80
            ..|                  ||||  .|.||         ||.|....|:||:|:...||.:  
  Fly    89 YAAPAISYAHAAPAISYAAPTVVKSYAAPVAVKVAAPATSYSHFSSVVSHATPIVKSYAAPAI-- 151

  Fly    81 TAVHSAPVLAAAPIVKTLA----PVAYSAP-LAYSAPVAYSSYAAP-LTYSAPVAYSAPLSYAAP 139
              .::||    ||::|:.|    ..|::|| ::|:||....||||| ::|:||....   |||||
  Fly   152 --AYAAP----APVIKSYAAPAISYAHAAPAISYAAPTVVKSYAAPAISYAAPALVK---SYAAP 207

  Fly   140 A 140
            |
  Fly   208 A 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 21/85 (25%)
CG34205NP_001097407.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D4X2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.