powered by:
Protein Alignment CG4982 and CG13056
DIOPT Version :9
Sequence 1: | NP_648866.1 |
Gene: | CG4982 / 39794 |
FlyBaseID: | FBgn0036598 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_652414.2 |
Gene: | CG13056 / 50267 |
FlyBaseID: | FBgn0040794 |
Length: | 99 |
Species: | Drosophila melanogaster |
Alignment Length: | 54 |
Identity: | 21/54 - (38%) |
Similarity: | 30/54 - (55%) |
Gaps: | 7/54 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 VGYESYALPAAVSHQSSTVVHEKRPYWRPIVDHTPILKAAYAPATSISYAPLGY 89
||:....:|.||||||||:||...|....:: ||.|::.| ::|...||
Fly 41 VGHLVEHVPTAVSHQSSTIVHRSVPRTTSLL--TPALRSTY-----LNYPTWGY 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG4982 | NP_648866.1 |
None |
CG13056 | NP_652414.2 |
Retinin_C |
34..>83 |
CDD:282395 |
18/48 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34931 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.