powered by:
Protein Alignment CG4962 and CG34267
DIOPT Version :9
Sequence 1: | NP_648865.1 |
Gene: | CG4962 / 39793 |
FlyBaseID: | FBgn0036597 |
Length: | 123 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097464.1 |
Gene: | CG34267 / 5740365 |
FlyBaseID: | FBgn0085296 |
Length: | 77 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 41/71 - (57%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFKLIALISALCAVANA--GVISPYSHGYGLGYGAALAPAYAAPAVISHAPIIKSYAAPIVAH-P 62
||::||:|.||.|:|.| |.|.| .||:...|.:.|...:..|:.|.|::|: .|:|.| |
Fly 1 MFRIIAVIFALVAMAFAAPGYIEP---SYGVVPVAQVVPVVKSVPVVQHVPVVKN--VPVVQHVP 60
Fly 63 VATSYA 68
|..|||
Fly 61 VLKSYA 66
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34931 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.