DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4962 and CG13060

DIOPT Version :9

Sequence 1:NP_648865.1 Gene:CG4962 / 39793 FlyBaseID:FBgn0036597 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster


Alignment Length:99 Identity:36/99 - (36%)
Similarity:54/99 - (54%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLIALISALCAVANAGVISPYSHGYGLGYGAALAPAYAAPAVISHAPII----KSYAAPIVAH 61
            |||.|.:|:.|.|.|:||:|..:...:........:..::||:.:||..|.    |:...|:||.
  Fly     1 MFKFIGVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65

  Fly    62 PVATSYANTYKVATKAIPVVHAAPLVHAVPALHS 95
            .|.|:..:...||..|.||||:.|:|||.|.:||
  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHS 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4962NP_648865.1 None
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.