DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13049 and T06E4.14

DIOPT Version :9

Sequence 1:NP_730133.1 Gene:CG13049 / 39788 FlyBaseID:FBgn0036592 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001123005.1 Gene:T06E4.14 / 6418768 WormBaseID:WBGene00077691 Length:219 Species:Caenorhabditis elegans


Alignment Length:212 Identity:90/212 - (42%)
Similarity:98/212 - (46%) Gaps:62/212 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVLVALCVASAQAGL------------LPFHAP--APLAAPL----APAFA--APLAAPVATAGV 49
            ::...|.::|||..:            .|..||  ||||||:    .|.||  |||.||.|..  
 Worm     7 LLFAGLALSSAQVAINGPFLGRYYVAAKPVLAPGVAPLAAPVLAAAPPVFAAPAPLMAPPAPV-- 69

  Fly    50 VAPYASSFNAHRINHAVAYPVAPAPAPVAFAAPLPAPL----PVPVAAPAPVAFAAPAPL----- 105
               .|||            |...||||| |||| |||:    |.|:.||.....||||||     
 Worm    70 ---LASS------------PAFAAPAPV-FAAP-PAPVFAAPPAPLLAPPAPVMAAPAPLLAPPV 117

  Fly   106 -PVAA-----APAPVAFAAPAKVAFAAPAPVAAPLGFAPAPAPVAFAAPAKFGFGPFAAP---LA 161
             |||.     ||.|| .||||.....||||..|| .||||.||....||| |...|..||   ||
 Worm   118 PPVAPIVPAFAPRPV-LAAPAFAPALAPAPAFAP-AFAPAFAPAPAFAPA-FAPAPVLAPRPVLA 179

  Fly   162 APVPAPLAVAPKFAPAP 178
            ||..||  ..|.|||||
 Worm   180 APAFAP--AVPAFAPAP 194



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.