DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13067 and LOC5667232

DIOPT Version :10

Sequence 1:NP_648857.1 Gene:CG13067 / 39785 FlyBaseID:FBgn0036589 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_001688037.1 Gene:LOC5667232 / 5667232 VectorBaseID:AGAMI1_005864 Length:145 Species:Anopheles gambiae


Alignment Length:128 Identity:43/128 - (33%)
Similarity:55/128 - (42%) Gaps:63/128 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLFAI-VACVSAKPAVLA------------------------------SPLAYS----AYSAPY 36
            :|:.|: ::|.||||.:||                              :||||:    ||:||.
Mosquito     6 ICIAALAISCASAKPGLLAPVAAPVAYAAGPAVVTAQSSQVVARNYNGIAPLAYTAPAVAYAAPA 70

  Fly    37 VA------------------------AAPYSAAYTAAYTAPVAAAYSAYTYPYASAYSAYPYA 75
            ||                        ||||.|.|.|.|.||.||||:|   |||:||:| |||
Mosquito    71 VAKVAAPLAYAAPAPLAAAAYAAAPLAAPYVAPYAAPYAAPYAAAYAA---PYAAAYAA-PYA 129

Return to query results.
Submit another query.