DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13067 and CG13069

DIOPT Version :9

Sequence 1:NP_648857.1 Gene:CG13067 / 39785 FlyBaseID:FBgn0036589 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster


Alignment Length:80 Identity:44/80 - (55%)
Similarity:53/80 - (66%) Gaps:8/80 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYFALCLFAIVACVSAKPAVLASPLAYSAYSAPYVAAAPYSAAYTAAYTAPVAAAYSAYTY-- 63
            |||:||:.|||::|||:|||.::| ||   |||||.|||||.:|.|:..|....||.|.|..|  
  Fly     1 MFKFFAVALFALIACVAAKPGIVA-PL---AYSAPLVAAAPAAAVYSREYHGNFAAPYVASPYVA 61

  Fly    64 -PY-ASAYSAYPYAA 76
             || ||.|.|.||.|
  Fly    62 SPYVASPYVASPYVA 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13067NP_648857.1 None
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7659
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.