DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13067 and CG13679

DIOPT Version :9

Sequence 1:NP_648857.1 Gene:CG13067 / 39785 FlyBaseID:FBgn0036589 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_729345.1 Gene:CG13679 / 38919 FlyBaseID:FBgn0035856 Length:119 Species:Drosophila melanogaster


Alignment Length:99 Identity:47/99 - (47%)
Similarity:61/99 - (61%) Gaps:26/99 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KYFALCLFAIVACVSAKPAVL----ASPLAY--------SAYSAPYVA---------AAPYSAAY 46
            |:.|:|.||:||..:|||.::    |:||||        :||.|||.:         :|.:.|||
  Fly     2 KFIAVCFFAVVAVAAAKPGLVAPLAAAPLAYTAPAVVGSAAYVAPYASSYSAHSVAHSAAFPAAY 66

  Fly    47 TAAYTAPVAAAYSAYTYPYASAYSA--YPYAAYY 78
            ||||||||||||:|   |.|:||:|  .||||.|
  Fly    67 TAAYTAPVAAAYTA---PVAAAYAAPIAPYAAAY 97



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.