DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and AT1G33610

DIOPT Version :9

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_174625.3 Gene:AT1G33610 / 840255 AraportID:AT1G33610 Length:478 Species:Arabidopsis thaliana


Alignment Length:395 Identity:97/395 - (24%)
Similarity:154/395 - (38%) Gaps:94/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 NLTYLNL-AYNNLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFCG-LHTISQIYLTGNLLKEL 181
            :|:.::| .:.|:|.......:....|..:|:..|.:|. .:.|..| |..:.:|:|.||.....
plant   103 HLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSG-PLPANIGVLSLLEEIFLQGNKFTGP 166

  Fly   182 HNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLS 246
            ..:...:...|..:.|.|||||...|....|::.::.:.|.:|||....||.|.....|:.|.||
plant   167 IPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLS 231

  Fly   247 YNE---------------LKNFQLTEKNIVHQLHLDNNYLTNLTINATRFVRASHNQISELFLHQ 296
            .||               |...|:::.|:...:   .||:       :||.:             
plant   232 SNEFYGKLPLSIATLAPTLLALQVSQNNLSGAI---PNYI-------SRFNK------------- 273

  Fly   297 SLHIETLDLSANKLSSI-----SNITNI-----THML--------------YLDVSDNPIGPLNI 337
               :|.||||.|:.|.:     .|:|||     :|.|              |||:|.|   ...:
plant   274 ---LEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYN---QFQL 332

  Fly   338 STFSQ----LKRLRGLNLRGTGIR-ELKFGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKK 397
            .|..|    |..:..|.|...||: .|.....::..|...:|||.|.:: .:|:.|:.....|.:
plant   333 ETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEIS-GSLERFLNETRYLLE 396

  Fly   398 FLIDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPESVV----LNIEPDTN 458
            |....|.|....||.||...   |:.|.:|||          |:...:|.:|.    ||:..:..
plant   397 FRAAENKLRFDMGNLTFPRT---LKTLDLSRN----------LVFGKVPVTVAGLQRLNLSQNHL 448

  Fly   459 LDETP 463
            ..|.|
plant   449 CGELP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 97/395 (25%)
LRR_8 118..178 CDD:290566 15/60 (25%)
leucine-rich repeat 120..143 CDD:275380 4/23 (17%)
leucine-rich repeat 144..167 CDD:275380 7/23 (30%)
leucine-rich repeat 168..191 CDD:275380 4/22 (18%)
LRR_8 192..250 CDD:290566 22/72 (31%)
leucine-rich repeat 192..215 CDD:275380 9/22 (41%)
LRR_RI <207..432 CDD:238064 68/268 (25%)
leucine-rich repeat 216..239 CDD:275380 7/22 (32%)
leucine-rich repeat 240..299 CDD:275380 13/73 (18%)
LRR_8 299..356 CDD:290566 23/84 (27%)
leucine-rich repeat 300..321 CDD:275380 11/30 (37%)
leucine-rich repeat 322..345 CDD:275380 9/40 (23%)
LRR_8 344..405 CDD:290566 15/61 (25%)
leucine-rich repeat 346..365 CDD:275380 5/19 (26%)
leucine-rich repeat 370..394 CDD:275380 6/23 (26%)
leucine-rich repeat 395..420 CDD:275380 8/24 (33%)
AT1G33610NP_174625.3 PLN00113 29..>477 CDD:215061 97/395 (25%)
leucine-rich repeat 129..152 CDD:275380 7/23 (30%)
leucine-rich repeat 153..176 CDD:275380 4/22 (18%)
leucine-rich repeat 177..200 CDD:275380 9/22 (41%)
leucine-rich repeat 201..224 CDD:275380 7/22 (32%)
leucine-rich repeat 225..249 CDD:275380 6/23 (26%)
leucine-rich repeat 250..273 CDD:275380 7/32 (22%)
leucine-rich repeat 274..297 CDD:275380 8/22 (36%)
leucine-rich repeat 298..319 CDD:275380 3/20 (15%)
leucine-rich repeat 350..416 CDD:275380 19/66 (29%)
leucine-rich repeat 417..438 CDD:275380 8/30 (27%)
leucine-rich repeat 439..467 CDD:275380 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.