| Sequence 1: | NP_001261934.1 | Gene: | CG4950 / 39783 | FlyBaseID: | FBgn0036587 | Length: | 574 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001920877.1 | Gene: | si:ch211-237i5.4 / 557635 | ZFINID: | ZDB-GENE-131121-468 | Length: | 346 | Species: | Danio rerio |
| Alignment Length: | 237 | Identity: | 55/237 - (23%) |
|---|---|---|---|
| Similarity: | 102/237 - (43%) | Gaps: | 25/237 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 90 FETFPY-----LKTLDVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQTSVFIGANVLMRLDL 149
Fly 150 SYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMR 214
Fly 215 RIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNELKNFQLTEKNIVHQLH---LDNNYLTNLTI 276
Fly 277 NATRFVRAS-----------------HNQISELFLHQSLHIE 301 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4950 | NP_001261934.1 | leucine-rich repeat | 96..119 | CDD:275380 | 5/22 (23%) |
| LRR_8 | 118..178 | CDD:290566 | 15/59 (25%) | ||
| leucine-rich repeat | 120..143 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 144..167 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 168..191 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 192..250 | CDD:290566 | 17/57 (30%) | ||
| leucine-rich repeat | 192..215 | CDD:275380 | 7/22 (32%) | ||
| LRR_RI | <207..432 | CDD:238064 | 25/115 (22%) | ||
| leucine-rich repeat | 216..239 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 240..299 | CDD:275380 | 15/78 (19%) | ||
| LRR_8 | 299..356 | CDD:290566 | 1/3 (33%) | ||
| leucine-rich repeat | 300..321 | CDD:275380 | 0/2 (0%) | ||
| leucine-rich repeat | 322..345 | CDD:275380 | |||
| LRR_8 | 344..405 | CDD:290566 | |||
| leucine-rich repeat | 346..365 | CDD:275380 | |||
| leucine-rich repeat | 370..394 | CDD:275380 | |||
| leucine-rich repeat | 395..420 | CDD:275380 | |||
| si:ch211-237i5.4 | XP_001920877.1 | leucine-rich repeat | 34..53 | CDD:275380 | 3/11 (27%) |
| leucine-rich repeat | 54..75 | CDD:275380 | 5/20 (25%) | ||
| LRR_RI | <69..238 | CDD:238064 | 43/168 (26%) | ||
| LRR_8 | 75..134 | CDD:290566 | 15/58 (26%) | ||
| leucine-rich repeat | 76..99 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 122..182 | CDD:290566 | 15/59 (25%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 170..230 | CDD:290566 | 14/59 (24%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 220..240 | CDD:275380 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||